224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Inositol monophosphatase 1 |
|---|
Gene and Protein Information
| Gene ID | 3612 |
|---|---|
| Uniprot Accession IDs | P29218 B2R733 B4DLN3 B7Z6Q4 J3KQT7 Q9UK71 IMP 1 |
| Ensembl ID | ENSP00000408526 |
| Symbol | IMPA IMP IMPA MRT59 |
| Family | Belongs to the inositol monophosphatase superfamily. |
| Sequence | MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 100613673 | IMPA1 | inositol monophosphatase 1 | 9598 | VGNC:12290 | OMA, EggNOG |
| Macaque | 701959 | IMPA1 | inositol monophosphatase 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 55980 | Impa1 | inositol (myo)-1(or 4)-monophosphatase 1 | 10090 | MGI:1933158 | Inparanoid, OMA, EggNOG |
| Rat | 83523 | Impa1 | inositol monophosphatase 1 | 10116 | RGD:69254 | Inparanoid, OMA, EggNOG |
| Dog | 477925 | IMPA1 | inositol monophosphatase 1 | 9615 | VGNC:42007 | Inparanoid, OMA, EggNOG |
| Horse | 100050326 | IMPA1 | inositol monophosphatase 1 | 9796 | VGNC:19049 | Inparanoid, OMA, EggNOG |
| Cow | 281865 | IMPA1 | inositol monophosphatase 1 | 9913 | VGNC:30184 | Inparanoid, OMA, EggNOG |
| Pig | 397425 | IMPA1 | inositol monophosphatase 1 | 9823 | Inparanoid, EggNOG | |
| Opossum | 100019291 | IMPA1 | inositol monophosphatase 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100554351 | impa1 | inositol monophosphatase 1 | 28377 | Inparanoid, OMA | |
| Xenopus | 549811 | impa1 | inositol(myo)-1(or 4)-monophosphatase 1 | 8364 | XB-GENE-1004318 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.