The store will not work correctly when cookies are disabled.
JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
FABP2 Description Fatty acid-binding protein, intestinal
Gene and Protein Information Gene ID 2169 Uniprot Accession IDs P12104 Q2NKJ1 Ensembl ID ENSP00000274024 Symbol FABPI FABPI I-FABP Family Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. Sequence MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources Chimp 740421 FABP2 fatty acid binding protein 2 9598 VGNC:7045 OMA, EggNOG Mouse 14079 Fabp2 fatty acid binding protein 2, intestinal 10090 MGI:95478 Inparanoid, OMA, EggNOG Rat 25598 Fabp2 fatty acid binding protein 2 10116 RGD:2591 Inparanoid, OMA, EggNOG Dog 487924 FABP2 fatty acid binding protein 2 9615 VGNC:40560 Inparanoid, OMA, EggNOG Horse 100034050 FABP2 fatty acid binding protein 2 9796 VGNC:17767 OMA, EggNOG Cow FABP2 fatty acid binding protein 2 [Source:HGNC Symbol;Acc:HGNC:3556] 9913 OMA, EggNOG Opossum 100011805 FABP2 fatty acid binding protein 2 13616 Inparanoid, OMA, EggNOG Platypus 100081780 FABP2 fatty acid binding protein 2 9258 Inparanoid, OMA, EggNOG Chicken 422678 FABP2 fatty acid binding protein 2 9031 CGNC:9084 Inparanoid, OMA, EggNOG Anole lizard 100566943 fabp2 fatty acid binding protein 2 28377 Inparanoid, OMA, EggNOG Xenopus 100101805 fabp2 fatty acid binding protein 2 8364 XB-GENE-485137 Inparanoid, OMA, EggNOG Zebrafish 30708 fabp2 fatty acid binding protein 2, intestinal 7955 ZDB-GENE-991019-5 Inparanoid, OMA, EggNOG
Associated Recombinant Proteins Name Specification and purity Expression system Protein label Availability View Details
Associated Antibodies
Name Specifications Species reactivity Application Availability View Details
Associated Approved Drugs Associated Active Ligands Associated Diseases Name Direct Associated Targets Disease Type Mondoid
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Settings Agree All Decline
Shall we send you a message when we have discounts available?
Remind me later Allow
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.