🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

FTCD

DescriptionFormimidoyltransferase-cyclodeaminase

Gene and Protein Information

Gene ID10841
Uniprot Accession IDs O95954 B9EGD0 Q86V03 Q9HCT4 Q9HCT5 Q9HCT6 Q9UHJ2
Ensembl ID ENSP00000291670
Symbol LCHC1
FamilyIn the N-terminal section; belongs to the formiminotransferase family.
Sequence
MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque721818FTCDformimidoyltransferase cyclodeaminase9544OMA, EggNOG
Mouse14317Ftcdformiminotransferase cyclodeaminase10090MGI:1339962Inparanoid, OMA, EggNOG
Rat89833Ftcdformimidoyltransferase cyclodeaminase10116RGD:70915Inparanoid, OMA, EggNOG
Dog607685FTCDformimidoyltransferase cyclodeaminase9615VGNC:41002Inparanoid, OMA, EggNOG
Horse100049972FTCDformimidoyltransferase cyclodeaminase9796VGNC:18148Inparanoid, OMA, EggNOG
Cow535816FTCDformimidoyltransferase cyclodeaminase9913VGNC:29137Inparanoid, OMA, EggNOG
Pig397517FTCDformimidoyltransferase cyclodeaminase9823Inparanoid, OMA, EggNOG
Chicken395726FTCDformimidoyltransferase cyclodeaminase9031CGNC:4601Inparanoid, OMA, EggNOG
Anole lizard100558718ftcdformimidoyltransferase cyclodeaminase28377OMA, EggNOG
Xenopus448617ftcdformimidoyltransferase cyclodeaminase8364XB-GENE-963745Inparanoid, OMA, EggNOG
Zebrafish394052ftcdformimidoyltransferase cyclodeaminase7955ZDB-GENE-030131-9643Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    hydrolase    /    deaminase    /    Formimidoyltransferase-cyclodeaminase
protein    /    hydrolase    /    transferase    /    Formimidoyltransferase-cyclodeaminase
DTO Classes
protein    /    Enzyme    /    Hydrolase    /    Deaminase    /    Formimidoyltransferase-cyclodeaminase

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.