🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

GATA2

DescriptionEndothelial transcription factor GATA-2

Gene and Protein Information

Gene ID2624
Uniprot Accession IDs P23769 D3DNB3 Q53YE0 Q96BH0 Q96BH8 Q9BUJ6
Ensembl ID ENSP00000345681
Symbol DCML IMD21 NFE1B MONOMAC
Sequence
MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp460672GATA2GATA binding protein 29598VGNC:1824OMA, EggNOG
Macaque705551GATA2GATA binding protein 29544Inparanoid, OMA, EggNOG
Mouse14461Gata2GATA binding protein 210090MGI:95662Inparanoid, OMA, EggNOG
Rat25159Gata2GATA binding protein 210116RGD:2664Inparanoid, OMA, EggNOG
Dog484626GATA2GATA binding protein 29615VGNC:41122Inparanoid, OMA
Horse100049949GATA2GATA binding protein 29796VGNC:18255Inparanoid, OMA
Cow506809GATA2GATA binding protein 29913VGNC:29266Inparanoid, OMA
Pig396912GATA2GATA binding protein 29823Inparanoid, OMA
Opossum100017255GATA2GATA binding protein 213616Inparanoid, OMA
Chicken416018GATA2GATA binding protein 29031CGNC:4415Inparanoid, OMA
Anole lizardGATA2GATA binding protein 2 [Source:HGNC Symbol;Acc:HGNC:4171]28377Inparanoid, OMA
Xenopus100487142gata2GATA binding protein 28364XB-GENE-478165Inparanoid, OMA
Zebrafish30480gata2aGATA binding protein 2a7955ZDB-GENE-980526-260Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.