224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Galanin-like peptide |
|---|
Gene and Protein Information
| Gene ID | 85569 |
|---|---|
| Uniprot Accession IDs | Q9UBC7 A1KXL3 |
| Ensembl ID | ENSP00000349884 |
| Family | Belongs to the galanin family. |
| Sequence | MAPPSVPLVLLLVLLLSLAETPASAPAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKEEDVLKS |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 469110 | GALP | galanin like peptide | 9598 | VGNC:2400 | OMA, EggNOG |
| Macaque | 704323 | GALP | galanin like peptide | 9544 | Inparanoid, OMA | |
| Mouse | 232836 | Galp | galanin-like peptide | 10090 | MGI:2663979 | Inparanoid, OMA, EggNOG |
| Rat | 64568 | Galp | galanin-like peptide | 10116 | RGD:620187 | Inparanoid, OMA, EggNOG |
| Dog | 102151546 | GALP | galanin like peptide | 9615 | VGNC:41099 | Inparanoid, OMA, EggNOG |
| Horse | GALP | galanin like peptide [Source:HGNC Symbol;Acc:HGNC:24840] | 9796 | OMA, EggNOG | ||
| Pig | 396772 | GALP | galanin like peptide | 9823 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.