224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Insulin-like growth factor-binding protein 6 |
|---|
Gene and Protein Information
| Gene ID | 3489 |
|---|---|
| Uniprot Accession IDs | P24592 Q14492 IBP-6 |
| Ensembl ID | ENSP00000301464 |
| Symbol | IBP6 IBP6 |
| Sequence | MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 451929 | IGFBP6 | insulin like growth factor binding protein 6 | 9598 | VGNC:5428 | OMA, EggNOG |
| Mouse | 16012 | Igfbp6 | insulin-like growth factor binding protein 6 | 10090 | MGI:96441 | Inparanoid, OMA, EggNOG |
| Rat | 25641 | Igfbp6 | insulin-like growth factor binding protein 6 | 10116 | RGD:2877 | Inparanoid, OMA, EggNOG |
| Dog | 607374 | IGFBP6 | insulin like growth factor binding protein 6 | 9615 | VGNC:41907 | Inparanoid, OMA, EggNOG |
| Horse | 100034156 | IGFBP6 | insulin like growth factor binding protein 6 | 9796 | VGNC:18975 | Inparanoid, OMA, EggNOG |
| Cow | 404186 | IGFBP6 | insulin like growth factor binding protein 6 | 9913 | VGNC:30088 | Inparanoid, OMA, EggNOG |
| Pig | 100101923 | IGFBP6 | insulin like growth factor binding protein 6 | 9823 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.