The store will not work correctly when cookies are disabled.
JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
CGA Description Glycoprotein hormones alpha chain
Gene and Protein Information Gene ID 1081 Uniprot Accession IDs P01215 Ensembl ID ENSP00000482232 Symbol HCG LHA FSHA GPHa TSHA GPHA1 CG-ALPHA Family Belongs to the glycoprotein hormones subunit alpha family. Sequence MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources Chimp 462868 CGA glycoprotein hormones, alpha polypeptide 9598 OMA, EggNOG Macaque 697859 CGA glycoprotein hormones, alpha polypeptide 9544 Inparanoid, OMA, EggNOG Mouse 12640 Cga glycoprotein hormones, alpha subunit 10090 MGI:88390 Inparanoid, OMA, EggNOG Rat 116700 Cga glycoprotein hormones, alpha polypeptide 10116 RGD:620436 Inparanoid, OMA, EggNOG Dog 403483 CGA glycoprotein hormones, alpha polypeptide 9615 VGNC:39181 Inparanoid, OMA, EggNOG Horse 100034174 CGA glycoprotein hormones, alpha polypeptide 9796 VGNC:49352 Inparanoid, OMA, EggNOG Cow 280749 CGA glycoprotein hormones, alpha polypeptide 9913 VGNC:27257 Inparanoid, OMA, EggNOG Pig 406869 CGA glycoprotein hormones, alpha polypeptide 9823 Inparanoid, OMA, EggNOG Opossum 554198 CGA glycoprotein hormones, alpha polypeptide 13616 Inparanoid, OMA, EggNOG Platypus CGA glycoprotein hormones, alpha polypeptide [Source:HGNC Symbol;Acc:HGNC:1885] 9258 OMA, EggNOG Chicken 421829 CGA glycoprotein hormones, alpha polypeptide 9031 CGNC:11808 Inparanoid, OMA, EggNOG Xenopus 100488153 cga glycoprotein hormones, alpha polypeptide 8364 XB-GENE-478483 Inparanoid, OMA, EggNOG Zebrafish 402987 cga glycoprotein hormones, alpha polypeptide 7955 ZDB-GENE-040715-2 Inparanoid, OMA, EggNOG
Associated Recombinant Proteins Name Specification and purity Expression system Protein label Availability View Details
Associated Antibodies
Name Specifications Species reactivity Application Availability View Details
Associated Approved Drugs Associated Active Ligands Associated Diseases Name Direct Associated Targets Disease Type Mondoid
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Settings Agree All Decline
Shall we send you a message when we have discounts available?
Remind me later Allow
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.