The store will not work correctly when cookies are disabled.
JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
GLRX Description Glutaredoxin-1
Gene and Protein Information Gene ID 2745 Uniprot Accession IDs P35754 B2R4L2 Q3KQS1 Q6ICT1 Ensembl ID ENSP00000369314 Symbol GRX GRX GRX1 Family Belongs to the glutaredoxin family. Sequence MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources Chimp 736317 GLRX glutaredoxin 9598 VGNC:4016 Inparanoid, OMA Macaque 698997 GLRX glutaredoxin 9544 Inparanoid, OMA, EggNOG Mouse 93692 Glrx glutaredoxin 10090 MGI:2135625 Inparanoid, OMA, EggNOG Rat 64045 Glrx glutaredoxin 10116 RGD:70951 Inparanoid, OMA, EggNOG Dog 609246 GLRX glutaredoxin 9615 VGNC:41273 Inparanoid, OMA, EggNOG Horse 100064937 GLRX glutaredoxin 9796 VGNC:18390 Inparanoid, OMA, EggNOG Opossum 100009967 GLRX glutaredoxin 13616 Inparanoid, OMA, EggNOG Chicken 396069 GLRX glutaredoxin 9031 CGNC:49637 Inparanoid, OMA, EggNOG Anole lizard 100562408 glrx glutaredoxin 28377 Inparanoid, OMA, EggNOG Xenopus 549351 glrx glutaredoxin 8364 XB-GENE-971624 Inparanoid, OMA, EggNOG Zebrafish 449769 glrx glutaredoxin (thioltransferase) 7955 ZDB-GENE-041010-11 Inparanoid, OMA, EggNOG C. elegans 171685 glrx-10 GLutaRedoXin 6239 Inparanoid, OMA, EggNOG
Associated Recombinant Proteins Name Specification and purity Expression system Protein label Availability View Details
Associated Antibodies
Name Specifications Species reactivity Application Availability View Details
Associated Approved Drugs Associated Active Ligands Associated Diseases Name Direct Associated Targets Disease Type Mondoid
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Settings Agree All Decline
Shall we send you a message when we have discounts available?
Remind me later Allow
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.