224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | P2X purinoceptor 5 |
|---|
Gene and Protein Information
| Gene ID | 5026 |
|---|---|
| Uniprot Accession IDs | Q93086 G5E981 O43450 O75540 Q308M5 Q59F38 Q8IXW4 Q93087 Q9NZV0 P2X5 |
| Ensembl ID | ENSP00000225328 |
| Symbol | P2X5 P2X5 LRH-1 P2X5R |
| Family | Belongs to the P2X receptor family. |
| Sequence | MGQAGCKGLCLSLFDYKTEKYVIAKNKKVGLLYRLLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGPKNHYCPIFRLGSVIRWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSRLDNKLSKSVSSGYNFRFARYYRDAAGVEFRTLMKAYGIRFDVMVNGKGAFFCDLVLIYLIKKREFYRDKKYEEVRGLEDSSQEAEDEASGLGLSEQLTSGPGLLGMPEQQELQEPPEAKRGSSSQKGNGSVCPQLLEPHRST Show more |
Protein Classes
DTO Classes
protein / Ion channel / ATP-gated p2x receptor cation channel (p2x receptor) family / P2X purinoceptor 5
protein / Ion channel / ATP-gated p2x receptor cation channel (p2x receptor) family / P2X purinoceptor 5
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.