PAX8

DescriptionPaired box protein Pax-8

Gene and Protein Information

Gene ID7849
Uniprot Accession IDs Q06710 Q09155 Q16337 Q16338 Q16339 Q4ZG35 Q96J49
Ensembl ID ENSP00000263334
Sequence
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFPNSSLLSSPYYYSSTSRPSAPPTTATAFDHL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp459503PAX8paired box 89598VGNC:10736OMA, EggNOG
Macaque701906PAX8paired box 89544Inparanoid, OMA, EggNOG
Mouse18510Pax8paired box 810090MGI:97492Inparanoid, OMA, EggNOG
Rat81819Pax8paired box 810116RGD:620434Inparanoid, OMA, EggNOG
Dog403927PAX8paired box 89615VGNC:44279Inparanoid, OMA, EggNOG
Horse100065303PAX8paired box 89796VGNC:21178Inparanoid, OMA, EggNOG
Cow534661PAX8paired box 89913VGNC:32599Inparanoid, OMA, EggNOG
Opossum100026381PAX8paired box 813616Inparanoid, EggNOG
PlatypusPAX8paired box 8 [Source:HGNC Symbol;Acc:HGNC:8622]9258OMA, EggNOG
Xenopus780226pax8paired box 88364XB-GENE-483693Inparanoid, OMA
Zebrafish60637pax8paired box 87955ZDB-GENE-001030-3Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.