🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

PAK1

DescriptionSerine/threonine-protein kinase PAK 1

Gene and Protein Information

Gene ID5058
Uniprot Accession IDs Q13153 O75561 Q13567 Q32M53 Q32M54 Q86W79
Ensembl ID ENSP00000278568
Symbol IDDMSSD PAKalpha
FamilyBelongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
Sequence
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp451439PAK1p21 (RAC1) activated kinase 19598VGNC:48940OMA, EggNOG
Macaque698585PAK1p21 (RAC1) activated kinase 19544Inparanoid, OMA, EggNOG
Mouse18479Pak1p21 (RAC1) activated kinase 110090MGI:1339975Inparanoid, OMA
Rat29431Pak1p21 (RAC1) activated kinase 110116RGD:3250Inparanoid, OMA
Dog607885PAK1p21 (RAC1) activated kinase 19615VGNC:52285Inparanoid, OMA, EggNOG
Horse100063217PAK1p21 (RAC1) activated kinase 19796Inparanoid, OMA, EggNOG
Cow533729PAK1p21 (RAC1) activated kinase 19913VGNC:53657Inparanoid, OMA, EggNOG
Pig100525766PAK1p21 (RAC1) activated kinase 19823OMA, EggNOG
Opossum100018336PAK1p21 (RAC1) activated kinase 113616Inparanoid, OMA, EggNOG
Chicken419083PAK1p21 (RAC1) activated kinase 19031CGNC:432Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Kinase    /    Protein kinase    /    STE group    /    STE20 family    /    PAKA subfamily    /    Serine/threonine-protein kinase pak 1

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.