🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

PAK2

DescriptionSerine/threonine-protein kinase PAK 2

Gene and Protein Information

Gene ID5062
Uniprot Accession IDs Q13177 Q13154 Q6ISC3
Ensembl ID ENSP00000314067
Symbol PAK65 PAKgamma
FamilyBelongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
Sequence
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGTEKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp460965PAK2p21 (RAC1) activated kinase 29598VGNC:14627OMA, EggNOG
Macaque710314PAK2p21 (RAC1) activated kinase 29544Inparanoid, OMA, EggNOG
Mouse224105Pak2p21 (RAC1) activated kinase 210090MGI:1339984Inparanoid, OMA, EggNOG
Rat29432Pak2p21 (RAC1) activated kinase 210116RGD:61953Inparanoid, OMA, EggNOG
Dog612814PAK2p21 (RAC1) activated kinase 29615VGNC:53081Inparanoid, OMA, EggNOG
Horse100060183PAK2p21 (RAC1) activated kinase 29796Inparanoid, OMA, EggNOG
Cow513673PAK2p21 (RAC1) activated kinase 29913VGNC:53593Inparanoid, OMA, EggNOG
Pig100511837PAK2p21 (RAC1) activated kinase 29823Inparanoid, OMA, EggNOG
Opossum100015796PAK2p21 (RAC1) activated kinase 213616Inparanoid, OMA, EggNOG
Chicken424860PAK2p21 (RAC1) activated kinase 29031CGNC:4842Inparanoid, OMA
Anole lizard100561625pak2p21 (RAC1) activated kinase 228377Inparanoid, OMA
Xenopus733718pak2p21 protein (Cdc42/Rac)-activated kinase 28364XB-GENE-966302Inparanoid, OMA
Zebrafish266749pak2ap21 protein (Cdc42/Rac)-activated kinase 2a7955ZDB-GENE-021011-2Inparanoid, OMA
C. elegans180873pak-1Serine/threonine-protein kinase pak-16239Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Kinase    /    Protein kinase    /    STE group    /    STE20 family    /    PAKA subfamily    /    Serine/threonine-protein kinase pak 2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.