🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

P2RX4

DescriptionP2X purinoceptor 4

Gene and Protein Information

Gene ID5025
Uniprot Accession IDs Q99571 E7EPF7 F6RU17 O00450 O14722 Q5U089 Q5U090 Q8N4N1 Q9UBG9 P2X4
Ensembl ID ENSP00000353032
Symbol P2X4 P2X4R
FamilyBelongs to the P2X receptor family.
Sequence
MAGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYYREKKYKYVEDYEQGLASELDQ
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp452319P2RX4purinergic receptor P2X 49598VGNC:8487OMA, EggNOG
Macaque702536P2RX4purinergic receptor P2X 49544Inparanoid, OMA, EggNOG
Mouse18438P2rx4purinergic receptor P2X, ligand-gated ion channel 410090MGI:1338859Inparanoid, OMA, EggNOG
Rat29659P2rx4purinergic receptor P2X 410116RGD:62073Inparanoid, OMA, EggNOG
Dog448783P2RX4purinergic receptor P2X 49615VGNC:44210Inparanoid, OMA, EggNOG
Horse100059626P2RX4purinergic receptor P2X 49796VGNC:50960Inparanoid, OMA, EggNOG
Cow338036P2RX4purinergic receptor P2X 49913VGNC:32520Inparanoid, OMA, EggNOG
Opossum100618270P2RX4purinergic receptor P2X 413616Inparanoid, OMA, EggNOG
PlatypusP2RX4purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:HGNC:8535]9258OMA, EggNOG
Chicken374166P2RX4purinergic receptor P2X 49031CGNC:2857Inparanoid, OMA
Anole lizard100561452p2rx4purinergic receptor P2X 428377Inparanoid, OMA
Xenopus100489363p2rx4purinergic receptor P2X, ligand gated ion channel, 48364XB-GENE-967965Inparanoid, OMA
Zebrafish259258p2rx4apurinergic receptor P2X, ligand-gated ion channel, 4a7955ZDB-GENE-020806-2Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Ion channel    /    ATP-gated p2x receptor cation channel (p2x receptor) family    /    P2X purinoceptor 4

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.