🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

OPN4

DescriptionMelanopsin

Gene and Protein Information

Gene ID94233
Uniprot Accession IDs Q9UHM6 B7ZLB3 Q14D01 Q2PP22 Q8NGQ9
Ensembl ID ENSP00000361141
Symbol MOP MOP
FamilyBelongs to the G-protein coupled receptor 1 family. Opsin subfamily.
Sequence
MNPPSGPRVPPSPTQEPSCMATPAPPSWWDSSQSSISSLGRLPSISPTAPGTWAAAWVPLPTVDVPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRSRSLRTPANMFIINLAVSDFLMSFTQAPVFFTSSLYKQWLFGETGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFGVASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPAVRAYTMLLCCFVFFLPLLIIIYCYIFIFRAIRETGRALQTFGACKGNGESLWQRQRLQSECKMAKIMLLVILLFVLSWAPYSAVALVAFAGYAHVLTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAIAQHLPCLGVLLGVSRRHSRPYPSYRSTHRSTLTSHTSNLSWISIRRRQESLGSESEVGWTHMEAAAVWGAAQQANGRSLYGQGLEDLEAKAPPRPQGHEAETPGKTKGLIPSQDPRM
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp107966782OPN4opsin 49598VGNC:14323OMA, EggNOG
Macaque699800OPN4opsin 49544OMA, EggNOG
Mouse30044Opn4opsin 4 (melanopsin)10090MGI:1353425Inparanoid, OMA, EggNOG
Rat192223Opn4opsin 410116RGD:621701Inparanoid, OMA
Dog611027OPN4opsin 49615VGNC:51909Inparanoid, OMA, EggNOG
Horse100052462OPN4opsin 49796VGNC:21041Inparanoid, OMA, EggNOG
Cow515152OPN4opsin 49913VGNC:32437Inparanoid, OMA, EggNOG
Pig100153077OPN4opsin 49823OMA, EggNOG
Opossum100026910OPN4opsin 413616Inparanoid, EggNOG
Chicken423609OPN4opsin 49031CGNC:52000Inparanoid, OMA, EggNOG
Anole lizard103280357opn4opsin 428377Inparanoid, OMA, EggNOG
XenopusOPN4opsin 4 [Source:HGNC Symbol;Acc:HGNC:14449]8364OMA, EggNOG
Zebrafish100884131opn4bopsin 4b7955ZDB-GENE-080415-3Inparanoid, OMA, EggNOG
Fruitfly42261Rh2Rhodopsin 27227FBgn0003248Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Melanopsin
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Melanopsin

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.