CDCA5

DescriptionSororin

Gene and Protein Information

Gene ID113130
Uniprot Accession IDs Q96FF9 A8K625
Ensembl ID ENSP00000275517
Symbol SORORIN
FamilyBelongs to the sororin family.
Sequence
MSGRRTRSGGAAQRSGPRAPSPTKPLRRSQRKSGSELPSILPEIWPKTPSAAAVRKPIVLKRIVAHAVEVPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQKRKKKKMPEILKTELDEWAAAMNAEFEAAEQFDLLVE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp451310CDCA5cell division cycle associated 59598VGNC:11291OMA, EggNOG
Macaque721998CDCA5cell division cycle associated 59544Inparanoid, EggNOG
Mouse67849Cdca5cell division cycle associated 510090MGI:1915099Inparanoid, OMA, EggNOG
Rat684771Cdca5cell division cycle associated 510116RGD:1560863Inparanoid, EggNOG
Dog612071CDCA5cell division cycle associated 59615VGNC:39015Inparanoid, OMA, EggNOG
Horse100050887CDCA5cell division cycle associated 59796VGNC:16311Inparanoid, OMA, EggNOG
Cow613318CDCA5cell division cycle associated 59913Inparanoid, EggNOG
Xenopus100145078cdca5cell division cycle associated 58364XB-GENE-5908127Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.