224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Nuclear migration protein nudC |
|---|
Gene and Protein Information
| Gene ID | 10726 |
|---|---|
| Uniprot Accession IDs | Q9Y266 Q5QP31 Q5QP35 Q9H0N2 Q9Y2B6 |
| Ensembl ID | ENSP00000319664 |
| Symbol | HNUDC MNUDC NPD011 |
| Family | Belongs to the nudC family. |
| Sequence | MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTRREKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 737457 | NUDC | nuclear distribution C, dynein complex regulator | 9598 | VGNC:1420 | OMA, EggNOG |
| Macaque | NUDC | nuclear distribution C, dynein complex regulator [Source:HGNC Symbol;Acc:HGNC:8045] | 9544 | Inparanoid, OMA, EggNOG | ||
| Mouse | 18221 | Nudc | nudC nuclear distribution protein | 10090 | MGI:106014 | Inparanoid, OMA, EggNOG |
| Rat | 29648 | Nudc | nuclear distribution C, dynein complex regulator | 10116 | RGD:3215 | Inparanoid, OMA |
| Dog | 487349 | NUDC | nuclear distribution C, dynein complex regulator | 9615 | VGNC:44021 | Inparanoid, OMA, EggNOG |
| Horse | 100070978 | NUDC | nuclear distribution C, dynein complex regulator | 9796 | VGNC:20937 | Inparanoid, OMA, EggNOG |
| Cow | 513277 | NUDC | nuclear distribution C, dynein complex regulator | 9913 | VGNC:32321 | Inparanoid, OMA, EggNOG |
| Pig | 100511023 | NUDC | nuclear distribution C, dynein complex regulator | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100016788 | NUDC | nuclear distribution C, dynein complex regulator | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 419578 | NUDC | nuclear distribution C, dynein complex regulator | 9031 | CGNC:591 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100556216 | nudc | nuclear distribution C, dynein complex regulator | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100380054 | nudc | nudC nuclear distribution protein | 8364 | XB-GENE-985468 | Inparanoid, OMA, EggNOG |
| C. elegans | 176754 | nud-1 | Aspergillus NUclear Division related | 6239 | Inparanoid, OMA | |
| Fruitfly | 39879 | nudC | CG9710 gene product from transcript CG9710-RB | 7227 | FBgn0021768 | Inparanoid, EggNOG |
Protein Classes
PANTHER Classes
protein / cytoskeletal protein / microtubule family cytoskeletal protein / Nuclear migration protein nudC
protein / cytoskeletal protein / microtubule family cytoskeletal protein / Nuclear migration protein nudC
DTO Classes
protein / Cellular structure / Microtubule family cytoskeletal protein / Nuclear migration protein nudC
protein / Cellular structure / Microtubule family cytoskeletal protein / Nuclear migration protein nudC
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.