224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Olfactory marker protein |
|---|
Gene and Protein Information
| Gene ID | 4975 |
|---|---|
| Uniprot Accession IDs | P47874 Q562G2 |
| Ensembl ID | ENSP00000436376 |
| Family | Belongs to the olfactory marker protein family. |
| Sequence | MAEDRPQQPQLDMPLVLDQGLTRQMRLRVESLKQRGEKRQDGEKLLQPAESVYRLNFTQQQRLQFERWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKASVVFNQL |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 18378 | Omp | olfactory marker protein | 10090 | MGI:97436 | Inparanoid, OMA |
| Anole lizard | 100556277 | omp | olfactory marker protein | 28377 | Inparanoid, OMA | |
| Zebrafish | 574006 | ompa | olfactory marker protein a | 7955 | ZDB-GENE-050626-118 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.