🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

NOTUM

DescriptionPalmitoleoyl-protein carboxylesterase NOTUM

Gene and Protein Information

Gene ID147111
Uniprot Accession IDs Q6P988 Q8N410 Q8NI82
Ensembl ID ENSP00000387310
Symbol hNOTUM
FamilyBelongs to the pectinacetylesterase family. Notum subfamily.
Sequence
MGRGVRVLLLLSLLHCAGGSEGRKTWRRRGQQPPPPPRTEAAPAAGQPVESFPLDFTAVEGNMDSFMAQVKSLAQSLYPCSAQQLNEDLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRWLLFLEGGWYCFNRENCDSRYDTMRRLMSSRDWPRTRTGTGILSSQPEENPYWWNANMVFIPYCSSDVWSGASSKSEKNEYAFMGALIIQEVVRELLGRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFLDNKQYRHTDCVDTITCAPTEAIRRGIRYWNGVVPERCRRQFQEGEEWNCFFGYKVYPTLRCPVFVVQWLFDEAQLTVDNVHLTGQPVQEGLRLYIQNLGRELRHTLKDVPASFAPACLSHEIIIRSHWTDVQVKGTSLPRALHCWDRSLHDSHKASKTPLKGCPVHLVDSCPWPHCNPSCPTVRDQFTGQEMNVAQFLMHMGFDMQTVAQPQGLEPSELLGMLSNGS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp100609059NOTUMnotum, palmitoleoyl-protein carboxylesterase9598VGNC:9485OMA, EggNOG
Mouse77583Notumnotum palmitoleoyl-protein carboxylesterase10090MGI:1924833Inparanoid, OMA, EggNOG
Rat303743NotumNOTUM, palmitoleoyl-protein carboxylesterase10116RGD:1307119Inparanoid, OMA, EggNOG
Dog483374NOTUMnotum, palmitoleoyl-protein carboxylesterase9615VGNC:43901Inparanoid, OMA, EggNOG
Horse100054869NOTUMnotum, palmitoleoyl-protein carboxylesterase9796VGNC:20820Inparanoid, OMA, EggNOG
Opossum100029923NOTUMnotum, palmitoleoyl-protein carboxylesterase13616Inparanoid, OMA, EggNOG
Chicken417385NOTUMNOTUM, palmitoleoyl-protein carboxylesterase9031CGNC:2094Inparanoid, OMA, EggNOG
Anole lizard100564438notumnotum, palmitoleoyl-protein carboxylesterase28377Inparanoid, OMA, EggNOG
Xenopus100145278notumnotum, palmitoleoyl-protein carboxylesterase8364XB-GENE-996986Inparanoid, OMA, EggNOG
Zebrafish570510notum1anotum, palmitoleoyl-protein carboxylesterase a7955ZDB-GENE-120807-2Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.