224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Nuclear inhibitor of protein phosphatase 1 |
|---|
Gene and Protein Information
| Gene ID | 5511 |
|---|---|
| Uniprot Accession IDs | Q12972 Q5TEJ2 Q5TEJ4 Q5TIF2 Q6PKF6 Q9UBH1 Q9UBZ0 NIPP-1 |
| Ensembl ID | ENSP00000311677 |
| Symbol | ARD1 NIPP1 ARD1 ARD-1 NIPP1 NIPP-1 PRO2047 |
| Sequence | MAAAANSGSSLPLFDCPTWAGKPPPGLHLDVVKGDKLIEKLIIDEKKYYLFGRNPDLCDFTIDHQSCSRVHAALVYHKHLKRVFLIDLNSTHGTFLGHIRLEPHKPQQIPIDSTVSFGASTRAYTLREKPQTLPSAVKGDEKMGGEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTLTIEEGNLDIQRPKRKRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 469247 | PPP1R8 | protein phosphatase 1 regulatory subunit 8 | 9598 | VGNC:6961 | OMA, EggNOG |
| Mouse | 100336 | Ppp1r8 | protein phosphatase 1, regulatory (inhibitor) subunit 8 | 10090 | MGI:2140494 | Inparanoid, OMA, EggNOG |
| Rat | 313030 | Ppp1r8 | protein phosphatase 1, regulatory subunit 8 | 10116 | RGD:1306280 | Inparanoid, OMA |
| Horse | 100056729 | PPP1R8 | protein phosphatase 1 regulatory subunit 8 | 9796 | VGNC:21771 | Inparanoid, OMA, EggNOG |
| Cow | 282319 | PPP1R8 | protein phosphatase 1 regulatory subunit 8 | 9913 | VGNC:33249 | Inparanoid, OMA, EggNOG |
| Pig | 100627843 | PPP1R8 | protein phosphatase 1 regulatory subunit 8 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100014423 | PPP1R8 | protein phosphatase 1 regulatory subunit 8 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 419564 | PPP1R8 | protein phosphatase 1 regulatory subunit 8 | 9031 | CGNC:463 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100555696 | ppp1r8 | protein phosphatase 1 regulatory subunit 8 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 549833 | ppp1r8 | protein phosphatase 1 regulatory subunit 8 | 8364 | XB-GENE-479608 | Inparanoid, OMA, EggNOG |
| Zebrafish | 566830 | ppp1r8a | protein phosphatase 1, regulatory subunit 8a | 7955 | ZDB-GENE-060503-681 | OMA, EggNOG |
| C. elegans | 172955 | B0511.7 | hypothetical protein | 6239 | Inparanoid, EggNOG | |
| Fruitfly | 44748 | NiPp1 | Nuclear inhibitor of Protein phosphatase 1 | 7227 | FBgn0026402 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.