NMI

DescriptionN-myc-interactor

Gene and Protein Information

Gene ID9111
Uniprot Accession IDs Q13287 B5BU69 Q53TI8 Q8WTW2 Q9BVE5 Nmi
Ensembl ID ENSP00000243346
FamilyBelongs to the NMI family.
Sequence
MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEIQKGQALITFEKEEVAQNVVSMSKHHVQIKDVNLEVTAKPVPLNSGVRFQVYVEVSKMKINVTEIPDTLREDQMRDKLELSFSKSRNGGGEVDRVDYDRQSGSAVITFVEIGVADKILKKKEYPLYINQTCHRVTVSPYTEIHLKKYQIFSGTSKRTVLLTGMEGIQMDEEIVEDLINIHFQRAKNGGGEVDVVKCSLGQPHIAYFEE
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp470714NMIN-myc and STAT interactor9598VGNC:2713OMA, EggNOG
Macaque694554NMIN-myc and STAT interactor9544Inparanoid, OMA, EggNOG
Mouse64685NmiN-myc (and STAT) interactor10090MGI:1928368Inparanoid, OMA, EggNOG
Rat311021NmiN-myc (and STAT) interactor10116RGD:1311721Inparanoid, OMA
Dog476146NMIN-myc and STAT interactor9615VGNC:43861Inparanoid, OMA, EggNOG
Horse100050154NMIN-myc and STAT interactor9796VGNC:20779Inparanoid, OMA, EggNOG
Cow511280NMIN-myc and STAT interactor9913OMA, EggNOG
Pig100621233NMIN-myc and STAT interactor9823OMA, EggNOG
Opossum100019843NMIN-myc and STAT interactor13616Inparanoid, OMA, EggNOG
Chicken424314NMIN-myc and STAT interactor9031CGNC:9480Inparanoid, OMA, EggNOG
Anole lizardNMIN-myc and STAT interactor [Source:HGNC Symbol;Acc:HGNC:7854]28377Inparanoid, OMA, EggNOG
Xenopus613094nmiN-myc and STAT interactor8364XB-GENE-492655Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    transcription factor    /    transcription cofactor    /    N-myc-interactor
DTO Classes
protein    /    Transcription factor    /    Transcription cofactor    /    N-myc-interactor

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.