The store will not work correctly when cookies are disabled.
JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
NOP10 Description H/ACA ribonucleoprotein complex subunit 3
Gene and Protein Information Gene ID 55505 Uniprot Accession IDs Q9NPE3 Ensembl ID ENSP00000332198 Symbol NOLA3 DKCB1 NOLA3 NOP10P Family Belongs to the NOP10 family. Sequence MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources Chimp 746535 NOP10 NOP10 ribonucleoprotein 9598 VGNC:1907 OMA, EggNOG Mouse 66181 Nop10 NOP10 ribonucleoprotein 10090 MGI:1913431 Inparanoid, OMA, EggNOG Dog 607299 NOP10 NOP10 ribonucleoprotein 9615 VGNC:43886 Inparanoid, OMA, EggNOG Horse 100630310 NOP10 NOP10 ribonucleoprotein 9796 VGNC:20805 Inparanoid, OMA, EggNOG Cow 616675 NOP10 NOP10 ribonucleoprotein 9913 VGNC:32164 Inparanoid, OMA, EggNOG Opossum 100015275 LOC100015275 H/ACA ribonucleoprotein complex subunit 3 13616 OMA, EggNOG Anole lizard 100553390 nop10 NOP10 ribonucleoprotein 28377 Inparanoid, OMA, EggNOG Xenopus 548917 nop10 NOP10 ribonucleoprotein 8364 XB-GENE-1001719 Inparanoid, OMA, EggNOG Zebrafish 445391 nop10 NOP10 ribonucleoprotein homolog (yeast) 7955 ZDB-GENE-041007-4 Inparanoid, OMA C. elegans 172883 nola-3 Putative H/ACA ribonucleoprotein complex subunit 3 6239 Inparanoid, OMA, EggNOG Fruitfly 36135 CG7637 CG7637 gene product from transcript CG7637-RA 7227 FBgn0033548 Inparanoid, OMA, EggNOG S.cerevisiae 856471 NOP10 snoRNP complex protein NOP10 4932 S000007455 Inparanoid, OMA, EggNOG
Associated Recombinant Proteins Name Specification and purity Expression system Protein label Availability View Details
Associated Antibodies
Name Specifications Species reactivity Application Availability View Details
Associated Approved Drugs Associated Active Ligands Associated Diseases Name Direct Associated Targets Disease Type Mondoid
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Settings Agree All Decline
Shall we send you a message when we have discounts available?
Remind me later Allow
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.