🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

OSM

DescriptionOncostatin-M

Gene and Protein Information

Gene ID5008
Uniprot Accession IDs P13725 Q6FHP8 Q9UCP6 OSM
Ensembl ID ENSP00000215781
FamilyBelongs to the LIF/OSM family.
Sequence
MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp736338OSMoncostatin M9598VGNC:6023OMA, EggNOG
Macaque717994OSMoncostatin M9544Inparanoid, OMA, EggNOG
Mouse18413Osmoncostatin M10090MGI:104749Inparanoid, OMA, EggNOG
Rat289747Osmoncostatin M10116RGD:1585012Inparanoid, OMA, EggNOG
Dog611921OSMoncostatin M9615VGNC:44166Inparanoid, OMA, EggNOG
Horse100064031OSMoncostatin M9796VGNC:21074Inparanoid, OMA, EggNOG
Cow319086OSMoncostatin M9913VGNC:32474Inparanoid, OMA, EggNOG
Pig100152038OSMoncostatin M9823OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    interleukin superfamily    /    Oncostatin-M
DTO Classes
protein    /    Signaling    /    Cytokine    /    Interleukin superfamily    /    Oncostatin-M

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.