224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Neurogranin |
|---|
Gene and Protein Information
| Gene ID | 4900 |
|---|---|
| Uniprot Accession IDs | Q92686 Ng |
| Ensembl ID | ENSP00000284292 |
| Symbol | RC3 hng |
| Family | Belongs to the neurogranin family. |
| Sequence | MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 451638 | NRGN | neurogranin | 9598 | VGNC:3088 | OMA, EggNOG |
| Macaque | 716063 | NRGN | neurogranin | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 64011 | Nrgn | neurogranin | 10090 | MGI:1927184 | Inparanoid, OMA, EggNOG |
| Rat | 64356 | Nrgn | neurogranin | 10116 | RGD:61833 | Inparanoid, OMA, EggNOG |
| Horse | 100072257 | NRGN | neurogranin | 9796 | VGNC:20885 | Inparanoid, OMA |
| Cow | 616955 | NRGN | neurogranin | 9913 | VGNC:32262 | Inparanoid, OMA, EggNOG |
| Opossum | 100015568 | NRGN | neurogranin | 13616 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.