🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

PREPL

DescriptionProlyl endopeptidase-like

Gene and Protein Information

Gene ID9581
Uniprot Accession IDs Q4J6C6 A7E2X6 D6W5A3 O43163 Q4J6C3 Q4J6C4 Q4ZG39 Q6ZMW7 Q96DW7
Ensembl ID ENSP00000386543
Symbol KIAA0436 CMS22
FamilyBelongs to the peptidase S9A family.
Sequence
MQQKTKLFLQALKYSIPHLGKCMQKQHLNHYNFADHCYNRIKLKKYHLTKCLQNKPKISELARNIPSRSFSCKDLQPVKQENEKPLPENMDAFEKVRTKLETQPQEEYEIINVEVKHGGFVYYQEGCCLVRSKDEEADNDNYEVLFNLEELKLDQPFIDCIRVAPDEKYVAAKIRTEDSEASTCVIIKLSDQPVMEASFPNVSSFEWVKDEEDEDVLFYTFQRNLRCHDVYRATFGDNKRNERFYTEKDPSYFVFLYLTKDSRFLTINIMNKTTSEVWLIDGLSPWDPPVLIQKRIHGVLYYVEHRDDELYILTNVGEPTEFKLMRTAADTPAIMNWDLFFTMKRNTKVIDLDMFKDHCVLFLKHSNLLYVNVIGLADDSVRSLKLPPWACGFIMDTNSDPKNCPFQLCSPIRPPKYYTYKFAEGKLFEETGHEDPITKTSRVLRLEAKSKDGKLVPMTVFHKTDSEDLQKKPLLVHVYGAYGMDLKMNFRPERRVLVDDGWILAYCHVRGGGELGLQWHADGRLTKKLNGLADLEACIKTLHGQGFSQPSLTTLTAFSAGGVLAGALCNSNPELVRAVTLEAPFLDVLNTMMDTTLPLTLEELEEWGNPSSDEKHKNYIKRYCPYQNIKPQHYPSIHITAYENDERVPLKGIVSYTEKLKEAIAEHAKDTGEGYQTPNIILDIQPGGNHVIEDSHKKITAQIKFLYEELGLDSTSVFEDLKKYLKF
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp737963PREPLprolyl endopeptidase like9598VGNC:50340OMA, EggNOG
Macaque713980PREPLprolyl endopeptidase-like9544Inparanoid, OMA, EggNOG
Mouse213760Preplprolyl endopeptidase-like10090MGI:2441932Inparanoid, OMA, EggNOG
Rat298771Preplprolyl endopeptidase-like10116RGD:1310143Inparanoid, OMA, EggNOG
Dog474574PREPLprolyl endopeptidase like9615VGNC:44961Inparanoid, OMA, EggNOG
Horse100053492PREPLprolyl endopeptidase like9796VGNC:21828Inparanoid, OMA, EggNOG
Cow533479PREPLprolyl endopeptidase like9913VGNC:33311Inparanoid, OMA, EggNOG
Pig100526165PREPLprolyl endopeptidase-like9823OMA, EggNOG
Opossum100033368PREPLprolyl endopeptidase-like13616Inparanoid, EggNOG
Chicken421405PREPLprolyl endopeptidase-like9031CGNC:51480Inparanoid, OMA, EggNOG
Anole lizard100554370preplprolyl endopeptidase-like28377Inparanoid, OMA
Xenopus100498250preplprolyl endopeptidase-like8364XB-GENE-981635Inparanoid, OMA, EggNOG
Zebrafish796680preplprolyl endopeptidase like7955ZDB-GENE-090313-224Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.