NPS

DescriptionNeuropeptide S

Gene and Protein Information

Gene ID594857
Uniprot Accession IDs P0C0P6
Ensembl ID ENSP00000381105
Sequence
MISSVKLNLILVLSLSTMHVFWCYPVPSSKVSGKSDYFLILLNSCPTRLDRSKELAFLKPILEKMFVKRSFRNGVGTGMKKTSFQRAKS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp739817NPSneuropeptide S9598VGNC:4967OMA, EggNOG
Mouse100043254Npsneuropeptide S10090MGI:3642232Inparanoid, OMA, EggNOG
Rat100360071Npsneuropeptide S10116RGD:2324597Inparanoid, OMA, EggNOG
Dog111092983NPSneuropeptide S9615VGNC:53003Inparanoid, OMA, EggNOG
Pig106506150NPSneuropeptide S9823OMA, EggNOG
Opossum100020780NPSneuropeptide S13616Inparanoid, EggNOG
Anole lizardNPSneuropeptide S [Source:HGNC Symbol;Acc:HGNC:33940]28377Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.