224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Neuropeptide S |
|---|
Gene and Protein Information
| Gene ID | 594857 |
|---|---|
| Uniprot Accession IDs | P0C0P6 |
| Ensembl ID | ENSP00000381105 |
| Sequence | MISSVKLNLILVLSLSTMHVFWCYPVPSSKVSGKSDYFLILLNSCPTRLDRSKELAFLKPILEKMFVKRSFRNGVGTGMKKTSFQRAKS |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 739817 | NPS | neuropeptide S | 9598 | VGNC:4967 | OMA, EggNOG |
| Mouse | 100043254 | Nps | neuropeptide S | 10090 | MGI:3642232 | Inparanoid, OMA, EggNOG |
| Rat | 100360071 | Nps | neuropeptide S | 10116 | RGD:2324597 | Inparanoid, OMA, EggNOG |
| Dog | 111092983 | NPS | neuropeptide S | 9615 | VGNC:53003 | Inparanoid, OMA, EggNOG |
| Pig | 106506150 | NPS | neuropeptide S | 9823 | OMA, EggNOG | |
| Opossum | 100020780 | NPS | neuropeptide S | 13616 | Inparanoid, EggNOG | |
| Anole lizard | NPS | neuropeptide S [Source:HGNC Symbol;Acc:HGNC:33940] | 28377 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.