SERPINI1

DescriptionNeuroserpin

Gene and Protein Information

Gene ID5274
Uniprot Accession IDs Q99574 A8K217 D3DNP1 Q6AHZ4
Ensembl ID ENSP00000295777
Symbol PI12 PI12 neuroserpin
FamilyBelongs to the serpin family.
Sequence
MAFLGLFSLLVLQSMATGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQKEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp460834SERPINI1serpin family I member 19598VGNC:10044OMA, EggNOG
Macaque699483SERPINI1serpin family I member 19544Inparanoid, OMA, EggNOG
Mouse20713Serpini1serine (or cysteine) peptidase inhibitor, clade I, member 110090MGI:1194506Inparanoid, OMA, EggNOG
Rat116459Serpini1serpin family I member 110116RGD:619896Inparanoid, OMA, EggNOG
Dog478684SERPINI1serpin family I member 19615VGNC:46042Inparanoid, OMA, EggNOG
Horse100057410SERPINI1serpin family I member 19796VGNC:22863Inparanoid, OMA, EggNOG
Cow509976SERPINI1serpin family I member 19913VGNC:34481Inparanoid, OMA, EggNOG
Pig100154352SERPINI1serpin family I member 19823OMA, EggNOG
Opossum100010617SERPINI1serpin family I member 113616Inparanoid, OMA, EggNOG
Platypus100073875SERPINI1serpin family I member 19258Inparanoid, OMA, EggNOG
Chicken425002SERPINI1serpin family I member 19031CGNC:7200Inparanoid, OMA, EggNOG
Anole lizard100552314serpini1serpin family I member 128377Inparanoid, OMA, EggNOG
Xenopus100144746serpini1serpin family I member 18364XB-GENE-948443Inparanoid, OMA, EggNOG
Zebrafish557627serpini1serpin peptidase inhibitor, clade I (neuroserpin), member 17955ZDB-GENE-060503-390Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    serine protease inhibitor    /    Neuroserpin
DTO Classes
protein    /    Enzyme modulator    /    Protease inhibitor    /    Serine protease inhibitor    /    Neuroserpin

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.