224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Neuropeptide Y receptor type 4 |
|---|
Gene and Protein Information
| Gene ID | 100996758 |
|---|---|
| Uniprot Accession IDs | P50391 Q13456 Q5ISU3 Q5T2X9 Q6FH06 NPY4-R |
| Ensembl ID | ENSP00000363431 |
| Symbol | PPYR1 PP1 NPY4R PPYR1 NPY4-R CH17-360D5.1 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MNTSHLLALLLPKSPQGENRSKPLGTPYNFSEHCQDSVDVMVFIVTSYSIETVVGVLGNLCLMCVTVRQKEKANVTNLLIANLAFSDFLMCLLCQPLTAVYTIMDYWIFGETLCKMSAFIQCMSVTVSILSLVLVALERHQLIINPTGWKPSISQAYLGIVLIWVIACVLSLPFLANSILENVFHKNHSKALEFLADKVVCTESWPLAHHRTIYTTFLLLFQYCLPLGFILVCYARIYRRLQRQGRVFHKGTYSLRAGHMKQVNVVLVVMVVAFAVLWLPLHVFNSLEDWHHEAIPICHGNLIFLVCHLLAMASTCVNPFIYGFLNTNFKKEIKALVLTCQQSAPLEESEHLPLSTVHTEVSKGSLRLSGRSNPI Show more |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Neuropeptide Y receptor / Neuropeptide Y receptor type 4
protein / G-protein coupled receptor / Class A rhodopsin like / Neuropeptide Y receptor / Neuropeptide Y receptor type 4
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.