224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | ADP-sugar pyrophosphatase |
|---|
Gene and Protein Information
| Gene ID | 11164 |
|---|---|
| Uniprot Accession IDs | Q9UKK9 A8K516 Q6IAG0 Q9UH49 |
| Ensembl ID | ENSP00000419628 |
| Symbol | NUDIX5 YSA1 YSA1H YSAH1 hNUDT5 |
| Family | Belongs to the Nudix hydrolase family. |
| Sequence | MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 450306 | NUDT5 | nudix hydrolase 5 | 9598 | VGNC:12411 | OMA, EggNOG |
| Macaque | 694368 | NUDT5 | nudix hydrolase 5 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 53893 | Nudt5 | nudix (nucleoside diphosphate linked moiety X)-type motif 5 | 10090 | MGI:1858232 | Inparanoid, OMA, EggNOG |
| Rat | 361274 | Nudt5 | nudix hydrolase 5 | 10116 | RGD:1359284 | Inparanoid, OMA, EggNOG |
| Dog | 478006 | NUDT5 | nudix hydrolase 5 | 9615 | VGNC:44034 | Inparanoid, OMA, EggNOG |
| Horse | 100056812 | NUDT5 | nudix hydrolase 5 | 9796 | VGNC:20949 | Inparanoid, OMA, EggNOG |
| Cow | 614149 | NUDT5 | nudix hydrolase 5 | 9913 | VGNC:32339 | Inparanoid, OMA, EggNOG |
| Opossum | NUDT5 | nudix hydrolase 5 [Source:HGNC Symbol;Acc:HGNC:8052] | 13616 | Inparanoid, OMA, EggNOG | ||
| Platypus | 100084986 | NUDT5 | nudix hydrolase 5 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 426368 | NUDT5 | nudix hydrolase 5 | 9031 | CGNC:52764 | OMA, EggNOG |
| Anole lizard | 100567214 | nudt5 | nudix hydrolase 5 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 549367 | nudt5 | nudix hydrolase 5 | 8364 | XB-GENE-980634 | Inparanoid, OMA, EggNOG |
| Zebrafish | 415176 | nudt5 | nudix (nucleoside diphosphate linked moiety X)-type motif 5 | 7955 | ZDB-GENE-040625-63 | Inparanoid, OMA |
| C. elegans | 189126 | ndx-2 | Putative nudix hydrolase 2 | 6239 | Inparanoid, OMA, EggNOG | |
| S.cerevisiae | 852408 | YSA1 | ADP-ribose diphosphatase | 4932 | S000000315 | Inparanoid, OMA, EggNOG |
Protein Classes
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.