224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | 10 kDa heat shock protein, mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 3336 |
|---|---|
| Uniprot Accession IDs | P61604 O95421 Q04984 Q53X54 Q9UDH0 Hsp10 |
| Ensembl ID | ENSP00000233893 |
| Symbol | EPF CPN10 GROES HSP10 |
| Family | Belongs to the GroES chaperonin family. |
| Sequence | MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 459853 | HSPE1 | heat shock protein family E (Hsp10) member 1 | 9598 | VGNC:10839 | OMA, EggNOG |
| Mouse | 15528 | Hspe1 | heat shock protein 1 (chaperonin 10) | 10090 | MGI:104680 | Inparanoid, OMA, EggNOG |
| Rat | 25462 | Hspe1 | heat shock protein family E member 1 | 10116 | RGD:2844 | Inparanoid, OMA |
| Horse | 100070523 | LOC100070523 | 10 kDa heat shock protein, mitochondrial | 9796 | OMA, EggNOG | |
| Cow | 281833 | HSPE1 | heat shock protein family E (Hsp10) member 1 | 9913 | VGNC:49071 | Inparanoid, OMA, EggNOG |
| Pig | 397575 | HSPE1 | heat shock protein family E (Hsp10) member 1 | 9823 | Inparanoid, OMA, EggNOG | |
| Chicken | 395948 | HSPE1 | heat shock protein family E (Hsp10) member 1 | 9031 | CGNC:49569 | Inparanoid, OMA |
| Anole lizard | HSPE1 | heat shock protein family E (Hsp10) member 1 [Source:HGNC Symbol;Acc:HGNC:5269] | 28377 | Inparanoid, OMA, EggNOG | ||
| Xenopus | 448701 | hspe1 | heat shock protein family E (Hsp10) member 1 | 8364 | XB-GENE-963412 | Inparanoid, OMA, EggNOG |
| Zebrafish | 58041 | hspe1 | heat shock 10 protein 1 | 7955 | ZDB-GENE-000906-2 | Inparanoid, OMA, EggNOG |
| C. elegans | 175315 | Y22D7AL.10 | hypothetical protein | 6239 | OMA, EggNOG | |
| S.cerevisiae | 854185 | HSP10 | Hsp10p | 4932 | S000005546 | Inparanoid, OMA, EggNOG |
Protein Classes
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.