IL21R

DescriptionInterleukin-21 receptor

Gene and Protein Information

Gene ID50615
Uniprot Accession IDs Q9HBE5 A8K9E8 D3DWF7 Q96HZ1 Q9HB91 IL-21 receptor
Ensembl ID ENSP00000338010
Symbol NILR NILR CD360 IMD56
FamilyBelongs to the type I cytokine receptor family. Type 4 subfamily.
Sequence
MPRGWAAPLLLLLLQGGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNPHLLLLLLLVIVFIPAFWSLKTHPLWRLWKKIWAVPSPERFFMPLYKGCSGDFKKWVGAPFTGSSLELGPWSPEVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPSFWPTAQNSGGSAYSEERDRPYGLVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLDAGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSPGGVSESEAGSPLAGLDMDTFDSGFVGSDCSSPVECDFTSPGDEGPPRSYLRQWVVIPPPLSSPGPQAS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque705759IL21Rinterleukin 21 receptor9544Inparanoid, OMA, EggNOG
Mouse60504Il21rinterleukin 21 receptor10090MGI:1890475Inparanoid, OMA, EggNOG
Rat308977Il21rinterleukin 21 receptor10116RGD:1304950Inparanoid, OMA, EggNOG
Dog608011IL21Rinterleukin 21 receptor9615VGNC:41968Inparanoid, OMA, EggNOG
Horse100066814IL21Rinterleukin 21 receptor9796VGNC:19017Inparanoid, OMA, EggNOG
Cow617967IL21Rinterleukin 21 receptor9913VGNC:30142Inparanoid, OMA, EggNOG
Pig100518723IL21Rinterleukin 21 receptor9823OMA, EggNOG
Opossum100016040IL21Rinterleukin 21 receptor13616Inparanoid, OMA, EggNOG
Chicken416586IL21Rinterleukin 21 receptor9031CGNC:4749Inparanoid, OMA, EggNOG
Anole lizard103281084il21rinterleukin 21 receptor28377Inparanoid, OMA
Xenopus100492452il21rinterleukin 21 receptor8364XB-GENE-490256Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    type I cytokine receptor    /    Interleukin-21 receptor
DTO Classes
protein    /    Receptor    /    Cytokine receptor    /    Type I cytokine receptor    /    Interleukin-21 receptor

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.