224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Interleukin-23 subunit alpha |
|---|
Gene and Protein Information
| Gene ID | 51561 |
|---|---|
| Uniprot Accession IDs | Q9NPF7 Q6NZ80 Q6NZ82 Q9H2A5 IL-23 subunit alpha |
| Ensembl ID | ENSP00000228534 |
| Symbol | SGRF P19 SGRF IL-23 IL-23A IL23P19 |
| Family | Belongs to the IL-6 superfamily. |
| Sequence | MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 467036 | IL23A | interleukin 23 subunit alpha | 9598 | VGNC:8422 | OMA, EggNOG |
| Macaque | 712627 | IL23A | interleukin 23 subunit alpha | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 83430 | Il23a | interleukin 23, alpha subunit p19 | 10090 | MGI:1932410 | Inparanoid, OMA, EggNOG |
| Rat | 155140 | Il23a | interleukin 23 subunit alpha | 10116 | RGD:620873 | Inparanoid, OMA, EggNOG |
| Dog | 481110 | IL23A | interleukin 23 subunit alpha | 9615 | VGNC:41972 | Inparanoid, OMA, EggNOG |
| Horse | 100034230 | IL23A | interleukin 23 subunit alpha | 9796 | VGNC:19021 | Inparanoid, OMA, EggNOG |
| Cow | 511022 | IL23A | interleukin 23 subunit alpha | 9913 | VGNC:30146 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / signaling molecule / interleukin superfamily / Interleukin-23 subunit alpha
protein / signaling molecule / interleukin superfamily / Interleukin-23 subunit alpha
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.