🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

AK4

DescriptionAdenylate kinase 4, mitochondrial

Gene and Protein Information

Gene ID205
Uniprot Accession IDs P27144 B2R927 D3DQ62 Q6IBH4 Q6NXQ5 Q8IUU9 AK 4
Ensembl ID ENSP00000378743
Symbol AK3 AK3L1 AK3 AK 4 AK3L1 AK3L2
FamilyBelongs to the adenylate kinase family. AK3 subfamily.
Sequence
MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp450169AK4adenylate kinase 49598VGNC:10539OMA, EggNOG
Mouse11639Ak4adenylate kinase 410090MGI:87979Inparanoid, OMA, EggNOG
Rat29223Ak4adenylate kinase 410116RGD:2078Inparanoid, OMA, EggNOG
Horse100069665AK4adenylate kinase 49796VGNC:15197Inparanoid, OMA, EggNOG
Cow517063AK4adenylate kinase 49913VGNC:25773Inparanoid, OMA, EggNOG
Chicken424697AK4adenylate kinase 49031CGNC:8384Inparanoid, OMA, EggNOG
Xenopus100495400ak4adenylate kinase 48364XB-GENE-959954Inparanoid, OMA, EggNOG
Zebrafish406590ak4adenylate kinase 47955ZDB-GENE-040426-2505Inparanoid, OMA, EggNOG
S.cerevisiae856917ADK2adenylate kinase ADK24932S000000972Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.