🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

IL7

DescriptionInterleukin-7

Gene and Protein Information

Gene ID3574
Uniprot Accession IDs P13232 A0N0L3 Q5FBY5 Q5FBY9 IL-7
Ensembl ID ENSP00000263851
Symbol IL-7
FamilyBelongs to the IL-7/IL-9 family.
Sequence
MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp464245IL7interleukin 79598VGNC:862OMA, EggNOG
Macaque574168IL7interleukin 79544OMA, EggNOG
Mouse16196Il7interleukin 710090MGI:96561Inparanoid, OMA, EggNOG
Rat25647Il7interleukin 710116RGD:2904Inparanoid, OMA, EggNOG
Dog751768IL7interleukin 79615VGNC:41995Inparanoid, OMA, EggNOG
Horse100059131IL7interleukin 79796VGNC:19037Inparanoid, OMA, EggNOG
Cow280827IL7interleukin 79913VGNC:30169Inparanoid, OMA, EggNOG
Pig397253IL7interleukin 79823Inparanoid, OMA, EggNOG
Opossum103106447IL7interleukin 713616Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.