🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

IL20

DescriptionInterleukin-20

Gene and Protein Information

Gene ID50604
Uniprot Accession IDs Q9NYY1 Q17RB3 Q2THG6 Q96QZ6 IL-20
Ensembl ID ENSP00000356065
Symbol ZCYTO10 IL-20 IL10D ZCYTO10
FamilyBelongs to the IL-10 family.
Sequence
MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp744201IL20interleukin 209598VGNC:1268OMA, EggNOG
Macaque694689IL20interleukin 209544Inparanoid, OMA, EggNOG
Mouse58181Il20interleukin 2010090MGI:1890473Inparanoid, OMA, EggNOG
Rat681112Il20interleukin 2010116RGD:1583578Inparanoid, OMA, EggNOG
Dog609203IL20interleukin 209615VGNC:41964Inparanoid, OMA, EggNOG
Horse100055632IL20interleukin 209796VGNC:19013Inparanoid, OMA, EggNOG
Cow515533IL20interleukin 209913VGNC:30138Inparanoid, OMA, EggNOG
OpossumIL20interleukin 20 [Source:HGNC Symbol;Acc:HGNC:6002]13616Inparanoid, OMA, EggNOG
Chicken428265IL20interleukin 209031CGNC:605OMA, EggNOG
Anole lizardIL24interleukin 24 [Source:HGNC Symbol;Acc:HGNC:11346]28377Inparanoid, OMA, EggNOG
Zebrafish100004224il19linterleukin 19 like7955ZDB-GENE-071121-1OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.