224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Homeobox protein Meis1 |
|---|
Gene and Protein Information
| Gene ID | 4211 |
|---|---|
| Uniprot Accession IDs | O00470 A8MV50 |
| Ensembl ID | ENSP00000272369 |
| Family | Belongs to the TALE/MEIS homeobox family. |
| Sequence | MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 459288 | MEIS1 | Meis homeobox 1 | 9598 | VGNC:295 | OMA, EggNOG |
| Mouse | 17268 | Meis1 | Meis homeobox 1 | 10090 | MGI:104717 | Inparanoid, OMA, EggNOG |
| Rat | 686117 | Meis1 | Meis homeobox 1 | 10116 | RGD:1585482 | Inparanoid, OMA, EggNOG |
| Dog | 474619 | MEIS1 | Meis homeobox 1 | 9615 | VGNC:43153 | Inparanoid, OMA |
| Cow | 613877 | MEIS1 | Meis homeobox 1 | 9913 | VGNC:31381 | Inparanoid, OMA |
| Platypus | MEIS1 | Meis homeobox 1 [Source:HGNC Symbol;Acc:HGNC:7000] | 9258 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / RNA binding protein / homeodomain transcription factor / Homeobox protein Meis1
protein / RNA binding protein / DNA-directed RNA polymerase / Homeobox protein Meis1
protein / RNA binding protein / homeodomain transcription factor / Homeobox protein Meis1
protein / RNA binding protein / DNA-directed RNA polymerase / Homeobox protein Meis1
DTO Classes
protein / Enzyme / Transferase / Nucleotidyltransferase / Polymerase / DNA-directed RNA polymerase / Homeobox protein Meis1
protein / Enzyme / Transferase / Nucleotidyltransferase / Polymerase / DNA-directed RNA polymerase / Homeobox protein Meis1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.