224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Interferon-induced transmembrane protein 2 |
|---|
Gene and Protein Information
| Gene ID | 10581 |
|---|---|
| Uniprot Accession IDs | Q01629 Q6FH82 Q96DA8 |
| Ensembl ID | ENSP00000484689 |
| Symbol | 1-8D DSPA2c |
| Family | Belongs to the CD225/Dispanin family. |
| Sequence | MNHIVQTFSPVNSGQPPNYEMLKEEQEVAMLGVPHNPAPPMSTVIHIRSETSVPDHVVWSLFNTLFMNTCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGIFMTILLIIIPVLVVQAQR |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 450916 | IFITM2 | interferon induced transmembrane protein 2 | 9598 | VGNC:1066 | Inparanoid, OMA, EggNOG |
| Mouse | 80876 | Ifitm2 | interferon induced transmembrane protein 2 | 10090 | MGI:1933382 | Inparanoid, OMA |
| Rat | 114709 | Ifitm2 | interferon induced transmembrane protein 2 | 10116 | RGD:69332 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.