🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

KIR3DL2

DescriptionKiller cell immunoglobulin-like receptor 3DL2

Gene and Protein Information

Gene ID3812
Uniprot Accession IDs P43630 Q13238 Q14947 Q14948 Q92684 Q95366 Q95367 Q95368
Ensembl ID ENSP00000325525
Symbol CD158K NKAT4 3DL2 p140 NKAT4 CD158K NKAT-4 NKAT4B KIR-3DL2
FamilyBelongs to the immunoglobulin superfamily.
Sequence
MSLTVVSMACVGFFLLQGAWPLMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLHVLIGTSVVIFLFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQLDHCVFIQRKISRPSQRPKTPLTDTSVYTELPNAEPRSKVVSCPRAPQSGLEGVF
Show more

Protein Classes

PANTHER Classes
protein    /    receptor    /    immunoglobulin receptor superfamily    /    Killer cell immunoglobulin-like receptor 3DL2
protein    /    receptor    /    defense/immunity protein    /    Killer cell immunoglobulin-like receptor 3DL2
protein    /    receptor    /    membrane-bound signaling molecule    /    Killer cell immunoglobulin-like receptor 3DL2
protein    /    receptor    /    protease inhibitor    /    Killer cell immunoglobulin-like receptor 3DL2
protein    /    receptor    /    cytokine receptor    /    Killer cell immunoglobulin-like receptor 3DL2
DTO Classes
protein    /    Receptor    /    Cytokine receptor    /    Immunoglobulin receptor superfamily    /    Killer cell immunoglobulin-like receptor 3DL2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.