KLK14

DescriptionKallikrein-14

Gene and Protein Information

Gene ID43847
Uniprot Accession IDs Q9P0G3 A7UNK5 Q1RMZ2 Q6B089 hK14
Ensembl ID ENSP00000375678
Symbol KLKL6 KLK-L6
FamilyBelongs to the peptidase S1 family. Kallikrein subfamily.
Sequence
MSLRVLGSGTWPSAPKMFLLLTALQVLAIAMTQSQEDENKIIGGHTCTRSSQPWQAALLAGPRRRFLCGGALLSGQWVITAAHCGRPILQVALGKHNLRRWEATQQVLRVVRQVTHPNYNSRTHDNDLMLLQLQQPARIGRAVRPIEVTQACASPGTSCRVSGWGTISSPIARYPASLQCVNINISPDEVCQKAYPRTITPGMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMERCALPGYPGVYTNLCKYRSWIEETMRDK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Mouse317653Klk14kallikrein related-peptidase 1410090MGI:2447564Inparanoid, OMA, EggNOG
Rat308562Klk14kallikrein related-peptidase 1410116RGD:1308606Inparanoid, OMA, EggNOG
Dog484348KLK14kallikrein related peptidase 149615VGNC:42481Inparanoid, OMA, EggNOG
Horse100067040KLK14kallikrein related peptidase 149796VGNC:19486Inparanoid, OMA, EggNOG
Cow613993KLK14kallikrein related peptidase 149913VGNC:30676Inparanoid, OMA, EggNOG
Opossum100028200KLK14kallikrein related peptidase 1413616Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.