🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

LDHA

DescriptionL-lactate dehydrogenase A chain

Gene and Protein Information

Gene ID3939
Uniprot Accession IDs P00338 B4DKQ2 B7Z5E3 D3DQY3 F8W819 Q53G53 Q6IBM7 Q6ZNV1 Q9UDE8 Q9UDE9 LDH-A
Ensembl ID ENSP00000445175
Symbol LDHM GSD11 PIG19 HEL-S-133P
FamilyBelongs to the LDH/MDH superfamily. LDH family.
Sequence
MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp451063LDHAlactate dehydrogenase A9598VGNC:1085Inparanoid, OMA, EggNOG
Macaque694309LDHAlactate dehydrogenase A9544Inparanoid, OMA, EggNOG
Mouse16828Ldhalactate dehydrogenase A10090MGI:96759Inparanoid, EggNOG
Rat24533Ldhalactate dehydrogenase A10116RGD:2996Inparanoid, OMA
Dog476882LDHAlactate dehydrogenase A9615Inparanoid, OMA, EggNOG
Horse100057016LDHAlactate dehydrogenase A9796VGNC:19618Inparanoid, OMA, EggNOG
Cow281274LDHAlactate dehydrogenase A9913Inparanoid, OMA, EggNOG
Pig407245LDHAlactate dehydrogenase A9823Inparanoid, OMA, EggNOG
Opossum503513LDHAlactate dehydrogenase A13616OMA, EggNOG
Chicken396221LDHAlactate dehydrogenase A9031CGNC:49707Inparanoid, OMA
Xenopus394758ldhalactate dehydrogenase A8364XB-GENE-480608OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    dehydrogenase    /    L-lactate dehydrogenase A chain
DTO Classes
protein    /    Enzyme    /    Oxidoreductase    /    Dehydrogenase    /    L-lactate dehydrogenase A chain

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.