224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Protein mago nashi homolog |
|---|
Gene and Protein Information
| Gene ID | 4116 |
|---|---|
| Uniprot Accession IDs | P61326 B1ARP8 B2R5A2 O35169 P50606 Q5SW69 |
| Ensembl ID | ENSP00000360525 |
| Symbol | MAGOHA MAGOH1 MAGOHA |
| Family | Belongs to the mago nashi family. |
| Sequence | MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 104001049 | MAGOH | mago homolog, exon junction complex subunit | 9598 | VGNC:11529 | OMA, EggNOG |
| Macaque | 714261 | MAGOH | mago homolog, exon junction complex core component | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 17149 | Magoh | mago homolog, exon junction complex core component | 10090 | MGI:1330312 | Inparanoid, OMA |
| Rat | 298385 | Magoh | mago homolog, exon junction complex core component | 10116 | RGD:1305174 | Inparanoid, OMA |
| Horse | 100060994 | MAGOH | mago homolog, exon junction complex core component | 9796 | Inparanoid, OMA | |
| Cow | 505417 | MAGOH | mago homolog, exon junction complex core component | 9913 | Inparanoid, OMA | |
| Xenopus | 100038130 | magoh | mago homolog, exon junction complex subunit | 8364 | XB-GENE-493540 | Inparanoid, OMA |
| C. elegans | 173073 | mag-1 | Protein mago nashi homolog | 6239 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.