🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

MGST3

DescriptionMicrosomal glutathione S-transferase 3

Gene and Protein Information

Gene ID4259
Uniprot Accession IDs O14880 B2R592 Q6ICN4 Microsomal GST-3
Ensembl ID ENSP00000356864
Symbol GST-III
FamilyBelongs to the MAPEG family.
Sequence
MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSIALLGLVGTTVCSAFQHLGWVKSGLGSGPKCCH
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp457477MGST3microsomal glutathione S-transferase 39598VGNC:6916OMA, EggNOG
Macaque695275MGST3microsomal glutathione S-transferase 39544Inparanoid, OMA, EggNOG
Mouse66447Mgst3microsomal glutathione S-transferase 310090MGI:1913697Inparanoid, OMA, EggNOG
Rat289197Mgst3microsomal glutathione S-transferase 310116RGD:1306373OMA, EggNOG
Dog609050MGST3microsomal glutathione S-transferase 39615VGNC:53121Inparanoid, OMA
Horse100058514MGST3microsomal glutathione S-transferase 39796VGNC:20168Inparanoid, OMA, EggNOG
Cow507346MGST3microsomal glutathione S-transferase 39913VGNC:31453Inparanoid, OMA, EggNOG
Pig733607MGST3microsomal glutathione S-transferase 39823Inparanoid, OMA, EggNOG
Opossum100012866MGST3microsomal glutathione S-transferase 313616Inparanoid, OMA, EggNOG
PlatypusMGST3microsomal glutathione S-transferase 3 [Source:HGNC Symbol;Acc:HGNC:7064]9258OMA, EggNOG
Chicken424404MGST3microsomal glutathione S-transferase 39031CGNC:2512Inparanoid, OMA, EggNOG
Anole lizard100567286mgst3microsomal glutathione S-transferase 328377Inparanoid, OMA, EggNOG
Xenopus448730mgst3microsomal glutathione S-transferase 38364XB-GENE-976812Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.