MYL2

DescriptionMyosin regulatory light chain 2, ventricular/cardiac muscle isoform

Gene and Protein Information

Gene ID4633
Uniprot Accession IDs P10916 Q16123 MLC-2
Ensembl ID ENSP00000228841
Symbol MLC2 MLC2 CMH10 MLC-2s/v
Sequence
MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque711937MYL2myosin light chain 29544Inparanoid, OMA, EggNOG
Mouse17906Myl2myosin, light polypeptide 2, regulatory, cardiac, slow10090MGI:97272Inparanoid, OMA, EggNOG
Rat363925Myl2myosin light chain 210116RGD:1564245Inparanoid, OMA
Dog403614MYL2myosin light chain 29615VGNC:43543Inparanoid, OMA, EggNOG
Horse100147688MYL2myosin light chain 29796VGNC:20483Inparanoid, OMA, EggNOG
Cow505519MYL2myosin light chain 29913VGNC:31800Inparanoid, OMA, EggNOG
Opossum100019715MYL2myosin light chain 213616Inparanoid, OMA, EggNOG
Platypus100074559MYL2myosin light chain 29258OMA, EggNOG
Chicken416874MYL2myosin, light chain 2, regulatory, cardiac, slow9031CGNC:50364Inparanoid, OMA
Anole lizard100566191myl2myosin light chain 228377Inparanoid, OMA
Xenopus100135705myl2myosin light chain 28364XB-GENE-482091Inparanoid, OMA
Zebrafish677750myl2bmyosin, light chain 2b, regulatory, cardiac, slow7955ZDB-GENE-060331-137Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    calmodulin    /    Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
protein    /    calcium-binding protein    /    actin family cytoskeletal protein    /    Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
DTO Classes
protein    /    Calcium-binding protein    /    Intracellular calcium-sensing protein    /    Calmodulin    /    Myosin regulatory light chain 2, ventricular/cardiac muscle isoform

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.