🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

MYL5

DescriptionMyosin light chain 5

Gene and Protein Information

Gene ID4636
Uniprot Accession IDs Q02045 Q8IXL8
Ensembl ID ENSP00000383023
Symbol MYLC2
Sequence
MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp750383MYL5myosin light chain 59598VGNC:48920OMA, EggNOG
Macaque697765MYL5myosin light chain 59544Inparanoid, OMA, EggNOG
Dog479135MYL5myosin light chain 59615VGNC:43545Inparanoid, OMA, EggNOG
Horse100051591MYL5myosin light chain 59796VGNC:20486Inparanoid, OMA, EggNOG
PigMYL5myosin light chain 5 [Source:HGNC Symbol;Acc:HGNC:7586]9823OMA, EggNOG
Opossum100027358MYL5myosin light chain 513616Inparanoid, OMA, EggNOG
PlatypusMYL5myosin light chain 5 [Source:HGNC Symbol;Acc:HGNC:7586]9258OMA, EggNOG
Anole lizard100560522myl5myosin light chain 528377Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    calmodulin    /    Myosin light chain 5
protein    /    calcium-binding protein    /    actin family cytoskeletal protein    /    Myosin light chain 5
DTO Classes
protein    /    Calcium-binding protein    /    Intracellular calcium-sensing protein    /    Calmodulin    /    Myosin light chain 5

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.