🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

MYF5

DescriptionMyogenic factor 5

Gene and Protein Information

Gene ID4617
Uniprot Accession IDs P13349 Q6ISR9 Myf-5
Ensembl ID ENSP00000228644
Symbol BHLHC2 EORVA bHLHc2
Sequence
MDVMDGCQFSPSEYFYDGSCIPSPEGEFGDEFVPRVAAFGAHKAELQGSDEDEHVRAPTGHHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPKVEILRNAIRYIESLQELLREQVENYYSLPGQSCSEPTSPTSNCSDGMPECNSPVWSRKSSTFDSIYCPDVSNVYATDKNSLSSLDCLSNIVDRITSSEQPGLPLQDLASLSPVASTDSQPATPGASSSRLIYHVL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp467081MYF5myogenic factor 59598VGNC:5493OMA, EggNOG
Macaque697426MYF5myogenic factor 59544Inparanoid, OMA, EggNOG
Mouse17877Myf5myogenic factor 510090MGI:97252Inparanoid, OMA, EggNOG
Rat299766Myf5myogenic factor 510116RGD:1308322Inparanoid, OMA, EggNOG
Dog482582MYF5myogenic factor 59615VGNC:43533Inparanoid, OMA, EggNOG
Horse100060703MYF5myogenic factor 59796VGNC:20475Inparanoid, OMA, EggNOG
Cow281335MYF5myogenic factor 59913VGNC:31792Inparanoid, OMA, EggNOG
Pig100153269MYF5myogenic factor 59823OMA, EggNOG
Opossum100013522MYF5myogenic factor 513616Inparanoid, OMA, EggNOG
Platypus100073499MYF5myogenic factor 59258Inparanoid, OMA, EggNOG
Chicken395633MYF5myogenic factor 59031CGNC:66206Inparanoid, OMA
Anole lizard100563408myf5myogenic factor 528377Inparanoid, OMA, EggNOG
Xenopus394529myf5myogenic factor 58364XB-GENE-493550Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transcription factor    /    basic helix-loop-helix transcription factor    /    Myogenic factor 5
protein    /    transcription factor    /    nucleic acid binding    /    Myogenic factor 5
DTO Classes
protein    /    Transcription factor    /    Basic helix-loop-helix transcription factor    /    Myogenic factor 5

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.