224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | NADH dehydrogenase [ubiquinone] 1 subunit C2 |
|---|
Gene and Protein Information
| Gene ID | 4718 |
|---|---|
| Uniprot Accession IDs | O95298 E9PNU8 E9PRB2 Q549M5 Q6FIH8 Q9UBJ9 |
| Ensembl ID | ENSP00000281031 |
| Symbol | HLC-1 B14.5b NADHDH2 CI-B14.5b |
| Family | Belongs to the complex I NDUFC2 subunit family. |
| Sequence | MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | NDUFC2 | NADH dehydrogenase [Source:RefSeq peptide;Acc:NP_001253103] | 9544 | Inparanoid, OMA | ||
| Mouse | 68197 | Ndufc2 | NADH:ubiquinone oxidoreductase subunit C2 | 10090 | MGI:1344370 | OMA, EggNOG |
| Rat | 293130 | Ndufc2 | NADH:ubiquinone oxidoreductase subunit C2 | 10116 | RGD:1307511 | OMA, EggNOG |
| Dog | 476794 | NDUFC2 | NADH:ubiquinone oxidoreductase subunit C2 | 9615 | OMA, EggNOG | |
| Cow | 338046 | NDUFC2 | NADH:ubiquinone oxidoreductase subunit C2 | 9913 | OMA, EggNOG | |
| Anole lizard | 100567411 | LOC100567411 | NADH dehydrogenase [ubiquinone] 1 subunit C2 | 28377 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.