NDUFC2

DescriptionNADH dehydrogenase [ubiquinone] 1 subunit C2

Gene and Protein Information

Gene ID4718
Uniprot Accession IDs O95298 E9PNU8 E9PRB2 Q549M5 Q6FIH8 Q9UBJ9
Ensembl ID ENSP00000281031
Symbol HLC-1 B14.5b NADHDH2 CI-B14.5b
FamilyBelongs to the complex I NDUFC2 subunit family.
Sequence
MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
MacaqueNDUFC2NADH dehydrogenase [Source:RefSeq peptide;Acc:NP_001253103]9544Inparanoid, OMA
Mouse68197Ndufc2NADH:ubiquinone oxidoreductase subunit C210090MGI:1344370OMA, EggNOG
Rat293130Ndufc2NADH:ubiquinone oxidoreductase subunit C210116RGD:1307511OMA, EggNOG
Dog476794NDUFC2NADH:ubiquinone oxidoreductase subunit C29615OMA, EggNOG
Cow338046NDUFC2NADH:ubiquinone oxidoreductase subunit C29913OMA, EggNOG
Anole lizard100567411LOC100567411NADH dehydrogenase [ubiquinone] 1 subunit C228377OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.