🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

NME3

DescriptionNucleoside diphosphate kinase 3

Gene and Protein Information

Gene ID4832
Uniprot Accession IDs Q13232 Q9BWH4 NDK 3
Ensembl ID ENSP00000219302
Symbol NDPKC NDPK-C NM23H3 DR-nm23 NM23-H3 c371H6.2
FamilyBelongs to the NDK family.
Sequence
MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp467867NME3NME/NM23 nucleoside diphosphate kinase 39598VGNC:13748OMA, EggNOG
Macaque722479NME3NME/NM23 nucleoside diphosphate kinase 39544OMA, EggNOG
Mouse79059Nme3NME/NM23 nucleoside diphosphate kinase 310090MGI:1930182Inparanoid, OMA, EggNOG
Rat85269Nme3NME/NM23 nucleoside diphosphate kinase 310116RGD:619879Inparanoid, OMA, EggNOG
Dog100856596NME3NME/NM23 nucleoside diphosphate kinase 39615VGNC:54050Inparanoid, OMA, EggNOG
Cow515663NME3NME/NM23 nucleoside diphosphate kinase 39913VGNC:32126Inparanoid, OMA, EggNOG
Pig100514398NME3NME/NM23 nucleoside diphosphate kinase 39823Inparanoid, OMA, EggNOG
Opossum100010534NME3NME/NM23 nucleoside diphosphate kinase 313616Inparanoid, OMA, EggNOG
Chicken416399NME3NME/NM23 nucleoside diphosphate kinase 39031CGNC:66258Inparanoid, OMA
Xenopus448695nme3NME/NM23 nucleoside diphosphate kinase 38364XB-GENE-999215Inparanoid, OMA, EggNOG
Zebrafish30085nme3NME/NM23 nucleoside diphosphate kinase 37955ZDB-GENE-000210-34Inparanoid, OMA
S.cerevisiae853798YNK1nucleoside diphosphate kinase4932S000001550Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Kinase    /    Unclassified protein    /    Nucleoside diphosphate kinase 3

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.