🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

NDUFS4

DescriptionNADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial

Gene and Protein Information

Gene ID4724
Uniprot Accession IDs O43181 Q9BS69
Ensembl ID ENSP00000296684
Symbol AQDQ CI-18 MC1DN1 CI-AQDQ CI-18 kDa
FamilyBelongs to the complex I NDUFS4 subunit family.
Sequence
MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSTWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp461878NDUFS4NADH:ubiquinone oxidoreductase subunit S49598VGNC:4096Inparanoid, OMA, EggNOG
Macaque704137NDUFS4NADH:ubiquinone oxidoreductase subunit S49544Inparanoid, OMA, EggNOG
Mouse17993Ndufs4NADH:ubiquinone oxidoreductase core subunit S410090MGI:1343135Inparanoid, OMA, EggNOG
Rat499529Ndufs4NADH:ubiquinone oxidoreductase subunit S410116RGD:1594380Inparanoid, OMA, EggNOG
Dog479335NDUFS4NADH:ubiquinone oxidoreductase subunit S49615VGNC:52003Inparanoid, OMA, EggNOG
Horse100063168NDUFS4NADH:ubiquinone oxidoreductase subunit S49796VGNC:49499Inparanoid, OMA, EggNOG
Cow327680NDUFS4NADH:ubiquinone oxidoreductase subunit S49913VGNC:50229Inparanoid, OMA, EggNOG
Opossum100031559NDUFS4NADH:ubiquinone oxidoreductase subunit S413616Inparanoid, OMA, EggNOG
PlatypusNDUFS4NADH:ubiquinone oxidoreductase subunit S4 [Source:HGNC Symbol;Acc:HGNC:7711]9258OMA, EggNOG
Chicken374122NDUFS4NADH:ubiquinone oxidoreductase subunit S49031CGNC:66185Inparanoid, OMA
Anole lizard100558063ndufs4NADH:ubiquinone oxidoreductase subunit S428377Inparanoid, OMA, EggNOG
Xenopus100125122ndufs4NADH:ubiquinone oxidoreductase subunit S48364XB-GENE-947419Inparanoid, OMA, EggNOG
Zebrafish573689ndufs4NADH dehydrogenase (ubiquinone) Fe-S protein 4, (NADH-coenzyme Q reductase)7955ZDB-GENE-050522-421Inparanoid, OMA, EggNOG
C. elegans172037lpd-5LiPid Depleted6239Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.