224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Non-homologous end-joining factor 1 |
|---|
Gene and Protein Information
| Gene ID | 79840 |
|---|---|
| Uniprot Accession IDs | Q9H9Q4 B8ZZA4 Q4ZFW7 Q6IA64 Q96JS9 |
| Ensembl ID | ENSP00000349313 |
| Symbol | XLF XLF |
| Family | Belongs to the XLF family. |
| Sequence | MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQEVQVGQKHQGAGDPHTSNSASLQGIDSQCVNQPEQLVSSAPTLSAPEKESTGTSGPLQRPQLSKVKRKKPRGLFS |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 742646 | NHEJ1 | non-homologous end joining factor 1 | 9598 | VGNC:2710 | OMA, EggNOG |
| Macaque | 701542 | NHEJ1 | non-homologous end joining factor 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 75570 | Nhej1 | nonhomologous end-joining factor 1 | 10090 | MGI:1922820 | Inparanoid, EggNOG |
| Rat | 363251 | Nhej1 | nonhomologous end-joining factor 1 | 10116 | RGD:1359338 | Inparanoid, OMA, EggNOG |
| Dog | 610570 | NHEJ1 | non-homologous end joining factor 1 | 9615 | VGNC:43797 | Inparanoid, OMA, EggNOG |
| Cow | 509157 | NHEJ1 | non-homologous end joining factor 1 | 9913 | VGNC:32064 | Inparanoid, OMA, EggNOG |
| Pig | 110255182 | NHEJ1 | non-homologous end joining factor 1 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100010576 | NHEJ1 | non-homologous end joining factor 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100565479 | nhej1 | non-homologous end joining factor 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100145147 | nhej1 | non-homologous end joining factor 1 | 8364 | XB-GENE-5750961 | Inparanoid, OMA, EggNOG |
| Zebrafish | 406593 | nhej1 | nonhomologous end-joining factor 1 | 7955 | ZDB-GENE-040426-2515 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.