224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Homeobox protein Nkx-3.1 |
|---|
Gene and Protein Information
| Gene ID | 4824 |
|---|---|
| Uniprot Accession IDs | Q99801 O15465 Q9H2P4 Q9H2P5 Q9H2P6 Q9H2P7 Q9HBG0 |
| Ensembl ID | ENSP00000370253 |
| Symbol | NKX3.1 NKX3A NKX3 BAPX2 NKX3A NKX3.1 |
| Family | Belongs to the NK-3 homeobox family. |
| Sequence | MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEPEPEGGRSRAGAQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRASLVSVYNSYPYYPYLYCVGSWSPAFW |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 743612 | NKX3-1 | NK3 homeobox 1 | 9598 | VGNC:14633 | OMA, EggNOG |
| Macaque | 710591 | NKX3-1 | NK3 homeobox 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 18095 | Nkx3-1 | NK3 homeobox 1 | 10090 | MGI:97352 | Inparanoid, OMA, EggNOG |
| Rat | 305999 | Nkx3-1 | NK3 homeobox 1 | 10116 | RGD:1305369 | Inparanoid, OMA, EggNOG |
| Horse | 100058172 | NKX3-1 | NK3 homeobox 1 | 9796 | VGNC:50729 | Inparanoid, EggNOG |
| Cow | 782252 | NKX3-1 | NK3 homeobox 1 | 9913 | VGNC:32105 | Inparanoid, OMA, EggNOG |
| Opossum | 100020925 | NKX3-1 | NK3 homeobox 1 | 13616 | Inparanoid, EggNOG | |
| Xenopus | 100038192 | nkx3-1 | NK3 homeobox 1 | 8364 | XB-GENE-479027 | Inparanoid, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / DNA binding protein / Homeobox protein Nkx-3.1
protein / nucleic acid binding / homeodomain transcription factor / Homeobox protein Nkx-3.1
protein / nucleic acid binding / DNA binding protein / Homeobox protein Nkx-3.1
protein / nucleic acid binding / homeodomain transcription factor / Homeobox protein Nkx-3.1
DTO Classes
protein / Transcription factor / Helix-turn-helix transcription factor / Homeodomain transcription factor / Homeobox protein Nkx-3.1
protein / Transcription factor / Helix-turn-helix transcription factor / Homeodomain transcription factor / Homeobox protein Nkx-3.1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.