224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Cysteine and glycine-rich protein 1 |
|---|
Gene and Protein Information
| Gene ID | 1465 |
|---|---|
| Uniprot Accession IDs | P21291 A8K268 Q5U0J2 |
| Ensembl ID | ENSP00000356275 |
| Symbol | CSRP CYRP CRP CRP1 CSRP CYRP D1S181E HEL-141 HEL-S-286 |
| Sequence | MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 457621 | CSRP1 | cysteine and glycine rich protein 1 | 9598 | VGNC:6739 | OMA, EggNOG |
| Macaque | 709693 | CSRP1 | cysteine and glycine rich protein 1 | 9544 | Inparanoid, OMA | |
| Mouse | 13007 | Csrp1 | cysteine and glycine-rich protein 1 | 10090 | MGI:88549 | Inparanoid, OMA, EggNOG |
| Rat | 29276 | Csrp1 | cysteine and glycine-rich protein 1 | 10116 | RGD:62053 | Inparanoid, OMA |
| Dog | 607054 | CSRP1 | cysteine and glycine rich protein 1 | 9615 | VGNC:39675 | Inparanoid, OMA |
| Horse | 100051956 | CSRP1 | cysteine and glycine rich protein 1 | 9796 | VGNC:16913 | Inparanoid, OMA |
| Cow | 615329 | CSRP1 | cysteine and glycine rich protein 1 | 9913 | VGNC:27773 | Inparanoid, OMA |
| Opossum | CSRP1 | cysteine and glycine rich protein 1 [Source:HGNC Symbol;Acc:HGNC:2469] | 13616 | Inparanoid, OMA | ||
| Chicken | 396176 | CSRP1 | cysteine and glycine rich protein 1 | 9031 | CGNC:188 | Inparanoid, OMA |
| Anole lizard | 100565898 | csrp1 | cysteine and glycine rich protein 1 | 28377 | Inparanoid, OMA | |
| Xenopus | 448688 | csrp1 | cysteine and glycine rich protein 1 | 8364 | XB-GENE-941448 | Inparanoid, OMA |
| Zebrafish | 791132 | csrp1b | cysteine and glycine-rich protein 1b | 7955 | ZDB-GENE-070112-252 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / cytoskeletal protein / actin family cytoskeletal protein / Cysteine and glycine-rich protein 1
protein / cytoskeletal protein / actin family cytoskeletal protein / Cysteine and glycine-rich protein 1
DTO Classes
protein / Cellular structure / Actin family cytoskeletal protein / Cysteine and glycine-rich protein 1
protein / Cellular structure / Actin family cytoskeletal protein / Cysteine and glycine-rich protein 1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.